Lineage for d6ioxb1 (6iox B:2-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906377Species Porphyromonas gingivalis [TaxId:431947] [368117] (2 PDB entries)
  8. 2906381Domain d6ioxb1: 6iox B:2-334 [368118]
    Other proteins in same PDB: d6ioxa2, d6ioxb2
    automated match to d2af4d_
    complexed with aco

Details for d6ioxb1

PDB Entry: 6iox (more details), 2.04 Å

PDB Description: crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa
PDB Compounds: (B:) Phosphotransacetylase

SCOPe Domain Sequences for d6ioxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ioxb1 c.77.1.0 (B:2-334) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
dliqdvirraqenkqrivlpegleprtleaadrlmadkvvniilignvdsvkakvaelgl
knldeaviidpnnhpkkqqytdlllqirqkkgltpekaaelvenplylgclivksgdadg
liagaqnttgdvlrpalqviktapgmtsvsgtfllftkakeygkdglllvadcavipnpt
adelaqiavatartakaiadieprvamlsfstkgsakhemtdkvveatrmaqemapdlli
dgemqadaalvervaalkapgsnvagkanvlvfptlevgniayklverlghaeavgpilq
gmaapvndlsrgcsvediyrmvaitanqaiaak

SCOPe Domain Coordinates for d6ioxb1:

Click to download the PDB-style file with coordinates for d6ioxb1.
(The format of our PDB-style files is described here.)

Timeline for d6ioxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ioxb2