| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
| Protein automated matches [190966] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries) |
| Domain d6iipa1: 6iip A:8-94 [368115] Other proteins in same PDB: d6iipa2 automated match to d1ri0a_ complexed with mes, so4 |
PDB Entry: 6iip (more details), 0.95 Å
SCOPe Domain Sequences for d6iipa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iipa1 b.34.9.2 (A:8-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkdlfpyke
ykdkfgksnkrkgfneglweiennpgv
Timeline for d6iipa1: