Lineage for d6iipa1 (6iip A:8-94)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394316Protein automated matches [190966] (1 species)
    not a true protein
  7. 2394317Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries)
  8. 2394318Domain d6iipa1: 6iip A:8-94 [368115]
    Other proteins in same PDB: d6iipa2
    automated match to d1ri0a_
    complexed with mes, so4

Details for d6iipa1

PDB Entry: 6iip (more details), 0.95 Å

PDB Description: apo-form structure of the hrp3 pwwp domain
PDB Compounds: (A:) Hepatoma-derived growth factor-related protein 3

SCOPe Domain Sequences for d6iipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iipa1 b.34.9.2 (A:8-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkdlfpyke
ykdkfgksnkrkgfneglweiennpgv

SCOPe Domain Coordinates for d6iipa1:

Click to download the PDB-style file with coordinates for d6iipa1.
(The format of our PDB-style files is described here.)

Timeline for d6iipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iipa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6iipb_