Lineage for d6iipb_ (6iip B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784697Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2784737Protein automated matches [190966] (1 species)
    not a true protein
  7. 2784738Species Human (Homo sapiens) [TaxId:9606] [188600] (9 PDB entries)
  8. 2784740Domain d6iipb_: 6iip B: [368113]
    Other proteins in same PDB: d6iipa2
    automated match to d1ri0a_
    complexed with mes, so4

Details for d6iipb_

PDB Entry: 6iip (more details), 0.95 Å

PDB Description: apo-form structure of the hrp3 pwwp domain
PDB Compounds: (B:) Hepatoma-derived growth factor-related protein 3

SCOPe Domain Sequences for d6iipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iipb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkdlfpyke
ykdkfgksnkrkgfneglweiennpgv

SCOPe Domain Coordinates for d6iipb_:

Click to download the PDB-style file with coordinates for d6iipb_.
(The format of our PDB-style files is described here.)

Timeline for d6iipb_: