Lineage for d6h46b_ (6h46 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612496Protein automated matches [190101] (7 species)
    not a true protein
  7. 2612518Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 2612541Domain d6h46b_: 6h46 B: [368105]
    Other proteins in same PDB: d6h46a1, d6h46a2
    automated match to d4drxe_
    complexed with gdp, so4

Details for d6h46b_

PDB Entry: 6h46 (more details), 2.22 Å

PDB Description: human kras in complex with darpin k13
PDB Compounds: (B:) darpin K13

SCOPe Domain Sequences for d6h46b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h46b_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkhga
dvnaadlhgqtplhlaamvghleivevllkygadvnakdtmgatplhlaaqsghleivev
llkngadvnaqdkfgktafdisidngnedlaeilqk

SCOPe Domain Coordinates for d6h46b_:

Click to download the PDB-style file with coordinates for d6h46b_.
(The format of our PDB-style files is described here.)

Timeline for d6h46b_: