Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries) |
Domain d6h46b_: 6h46 B: [368105] Other proteins in same PDB: d6h46a1, d6h46a2 automated match to d4drxe_ complexed with gdp, so4 |
PDB Entry: 6h46 (more details), 2.22 Å
SCOPe Domain Sequences for d6h46b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h46b_ d.211.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkhga dvnaadlhgqtplhlaamvghleivevllkygadvnakdtmgatplhlaaqsghleivev llkngadvnaqdkfgktafdisidngnedlaeilqk
Timeline for d6h46b_: