Lineage for d6h47b1 (6h47 B:2-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006633Domain d6h47b1: 6h47 B:2-154 [368084]
    Other proteins in same PDB: d6h47a_, d6h47b2
    automated match to d4drxe_
    complexed with so4

Details for d6h47b1

PDB Entry: 6h47 (more details), 1.7 Å

PDB Description: human kras in complex with darpin k19
PDB Compounds: (B:) darpin K19

SCOPe Domain Sequences for d6h47b1:

Sequence, based on SEQRES records: (download)

>d6h47b1 d.211.1.1 (B:2-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkrgad
vsaadlhgqsplhlaamvghleivevllkygadvnakdtmgatplhlaarsghleiveel
lkngadmnaqdkfgkttfdistdngnedlaeil

Sequence, based on observed residues (ATOM records): (download)

>d6h47b1 d.211.1.1 (B:2-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkrgad
vsaadlhgqsplhlaamvghleivevllkygadvnakdtmgatplhlaarsghleiveel
lkngadmnaqdkfgktdlaeil

SCOPe Domain Coordinates for d6h47b1:

Click to download the PDB-style file with coordinates for d6h47b1.
(The format of our PDB-style files is described here.)

Timeline for d6h47b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h47b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6h47a_