SCOPe 2.08: Domain d6h47b1: 6h47 B:2-154

Lineage for d6h47b1 (6h47 B:2-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)

8. Domain d6h47b1: 6h47 B:2-154 [368084]
   Other proteins in same PDB: d6h47a_, d6h47b2
   automated match to d4drxe_
   complexed with so4

Details for d6h47b1

PDB Entry: 6h47, 1.7 Å

PDB Description: human kras in complex with darpin k19

PDB Compounds: (B:) darpin K19

SCOPe Domain Sequences for d6h47b1:

Sequence, based on SEQRES records:

>d6h47b1 d.211.1.1 (B:2-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkrgad
vsaadlhgqsplhlaamvghleivevllkygadvnakdtmgatplhlaarsghleiveel
lkngadmnaqdkfgkttfdistdngnedlaeil

Sequence, based on observed residues (ATOM records):

>d6h47b1 d.211.1.1 (B:2-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnasdrwgwtplhlaawwghleivevllkrgad
vsaadlhgqsplhlaamvghleivevllkygadvnakdtmgatplhlaarsghleiveel
lkngadmnaqdkfgktdlaeil

Timeline for d6h47b1:

• d6h47b1 first appeared in SCOPe 2.07