Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein automated matches [190780] (4 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [368073] (2 PDB entries) |
Domain d6ghbc1: 6ghb C:1-122 [368074] Other proteins in same PDB: d6ghba2, d6ghbc2 automated match to d3gfka_ complexed with mg |
PDB Entry: 6ghb (more details), 3.1 Å
SCOPe Domain Sequences for d6ghbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ghbc1 c.47.1.12 (C:1-122) automated matches {Bacillus subtilis [TaxId: 224308]} mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvrs fq
Timeline for d6ghbc1: