Lineage for d6ghbc1 (6ghb C:1-122)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486268Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2486281Protein automated matches [190780] (4 species)
    not a true protein
  7. 2486285Species Bacillus subtilis [TaxId:224308] [368073] (2 PDB entries)
  8. 2486288Domain d6ghbc1: 6ghb C:1-122 [368074]
    Other proteins in same PDB: d6ghba2, d6ghbc2
    automated match to d3gfka_
    complexed with mg

Details for d6ghbc1

PDB Entry: 6ghb (more details), 3.1 Å

PDB Description: crystal structure of spx in complex with yjbh (oxidized)
PDB Compounds: (C:) Regulatory protein spx

SCOPe Domain Sequences for d6ghbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghbc1 c.47.1.12 (C:1-122) automated matches {Bacillus subtilis [TaxId: 224308]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvrs
fq

SCOPe Domain Coordinates for d6ghbc1:

Click to download the PDB-style file with coordinates for d6ghbc1.
(The format of our PDB-style files is described here.)

Timeline for d6ghbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ghbc2