SCOPe 2.08: Domain d6ghbc1: 6ghb C:1-122

Lineage for d6ghbc1 (6ghb C:1-122)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.12: ArsC-like [69518] (4 proteins)
   Pfam PF03960

6. Protein automated matches [190780] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [368073] (2 PDB entries)

8. Domain d6ghbc1: 6ghb C:1-122 [368074]
   Other proteins in same PDB: d6ghba2, d6ghbc2
   automated match to d3gfka_
   complexed with mg

Details for d6ghbc1

PDB Entry: 6ghb, 3.1 Å

PDB Description: crystal structure of spx in complex with yjbh (oxidized)

PDB Compounds: (C:) Regulatory protein spx

SCOPe Domain Sequences for d6ghbc1:

Sequence; same for both SEQRES and ATOM records:

>d6ghbc1 c.47.1.12 (C:1-122) automated matches {Bacillus subtilis [TaxId: 224308]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvrs
fq

Timeline for d6ghbc1:

• d6ghbc1 first appeared in SCOPe 2.07