SCOPe 2.08: Domain d6d9gb2: 6d9g B:133-236

Lineage for d6d9gb2 (6d9g B:133-236)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6d9gb2: 6d9g B:133-236 [368051]
   Other proteins in same PDB: d6d9ga1, d6d9ga2, d6d9ga3, d6d9gb1, d6d9gc1, d6d9gc2, d6d9gc3, d6d9gd1
   automated match to d1v7ml2

Details for d6d9gb2

PDB Entry: 6d9g, 2.3 Å

PDB Description: x-ray structure of the fab fragment of 15b8, a murine monoclonal antibody specific for the human serotonin transporter

PDB Compounds: (B:) antibody light chain fab

SCOPe Domain Sequences for d6d9gb2:

Sequence; same for both SEQRES and ATOM records:

>d6d9gb2 b.1.1.2 (B:133-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsvfppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrg

Timeline for d6d9gb2:

• d6d9gb2 first appeared in SCOPe 2.07