Lineage for d6dylc_ (6dyl C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2312849Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2312850Protein Cytochrome b562 [47177] (1 species)
  7. 2312851Species Escherichia coli [TaxId:562] [47178] (63 PDB entries)
  8. 2312927Domain d6dylc_: 6dyl C: [368049]
    automated match to d1m6ta_
    complexed with v

Details for d6dylc_

PDB Entry: 6dyl (more details), 1.69 Å

PDB Description: vanadyl-bound structure of the engineered cyt b562 variant, ch3y*
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dylc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dylc_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvyhiddalklanegkvkeaqaaaeqlkchrnaaiqkyl

SCOPe Domain Coordinates for d6dylc_:

Click to download the PDB-style file with coordinates for d6dylc_.
(The format of our PDB-style files is described here.)

Timeline for d6dylc_: