Lineage for d6dy8b_ (6dy8 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2311453Protein automated matches [190502] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)
  8. 3067986Domain d6dy8b_: 6dy8 B: [368048]
    automated match to d2bc5a_
    complexed with hec, mn

Details for d6dy8b_

PDB Entry: 6dy8 (more details), 1.9 Å

PDB Description: mn(ii)-bound structure of the engineered cyt cb562 variant, ch2ey
PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dy8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dy8b_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvyhiddalklanegkvkeaqaaaeqlkcecnachqkyr

SCOPe Domain Coordinates for d6dy8b_:

Click to download the PDB-style file with coordinates for d6dy8b_.
(The format of our PDB-style files is described here.)

Timeline for d6dy8b_:

  • d6dy8b_ is new in SCOPe 2.07-stable