Lineage for d6d5bj_ (6d5b J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767367Species Caldicellulosiruptor sp. [TaxId:1387557] [367999] (1 PDB entry)
  8. 2767377Domain d6d5bj_: 6d5b J: [368023]
    automated match to d4jo5a_
    complexed with ca

Details for d6d5bj_

PDB Entry: 6d5b (more details), 2 Å

PDB Description: structure of caldicellulosiruptor danielii cbm3 module of glycoside hydrolase wp_045175321
PDB Compounds: (J:) glycoside hydrolase WP_045175321

SCOPe Domain Sequences for d6d5bj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d5bj_ b.2.2.0 (J:) automated matches {Caldicellulosiruptor sp. [TaxId: 1387557]}
sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa
qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg
ndwswlqsmtsygenvkvtayidgvlvwgqeps

SCOPe Domain Coordinates for d6d5bj_:

Click to download the PDB-style file with coordinates for d6d5bj_.
(The format of our PDB-style files is described here.)

Timeline for d6d5bj_: