Lineage for d6dy6b_ (6dy6 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. Protein Cytochrome b562 [47177] (1 species)
  7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. Domain d6dy6b_: 6dy6 B: [368018]
    automated match to d2bc5a_
    complexed with 1pe, hec, mn

Details for d6dy6b_

PDB Entry: 6dy6 (more details), 1.8 Å

PDB Description: mn(ii)-bound structure of the engineered cyt cb562 variant, ch2e
PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dy6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dy6b_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvghiddalklanegkvkeaqaaaeqlkcecnachqkyr

SCOPe Domain Coordinates for d6dy6b_ are not available.

Timeline for d6dy6b_:

Domains from other chains:
(mouse over for more information)
d6dy6a_