Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (12 species) not a true protein |
Species Caldicellulosiruptor sp. [TaxId:1387557] [367999] (1 PDB entry) |
Domain d6d5bl_: 6d5b L: [368002] automated match to d4jo5a_ complexed with ca |
PDB Entry: 6d5b (more details), 2 Å
SCOPe Domain Sequences for d6d5bl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d5bl_ b.2.2.0 (L:) automated matches {Caldicellulosiruptor sp. [TaxId: 1387557]} sgqikvlyanketnsttntirpwlkvvntgsssidlsrvtirywytvdgdraqsaisdwa qigasnvtfkfvklsssvsgadyyleigfksgagqlqpgkdtgeiqirfnksdwsnynqg ndwswlqsmtsygenvkvtayidgvlvwgqeps
Timeline for d6d5bl_: