SCOPe 2.08: Domain d6qjna_: 6qjn A:

Lineage for d6qjna_ (6qjn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Human (Homo sapiens) [TaxId:9606] [74932] (10 PDB entries)

8. Domain d6qjna_: 6qjn A: [367977]
   automated match to d5w72a_
   mutant

Details for d6qjna_

PDB Entry: 6qjn, 1.8 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332g mutant: space group i4122

PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d6qjna_:

Sequence; same for both SEQRES and ATOM records:

>d6qjna_ b.36.1.1 (A:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
ipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngvd
lrnasheqaaialknagqtvtiiaqykpeeysrfeak

Timeline for d6qjna_:

• d6qjna_ first appeared in SCOPe 2.07