Lineage for d5zpua_ (5zpu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448557Protein Ran [52609] (2 species)
  7. 2448578Species Human (Homo sapiens) [TaxId:9606] [52611] (65 PDB entries)
  8. 3067913Domain d5zpua_: 5zpu A: [367975]
    Other proteins in same PDB: d5zpub_
    automated match to d2mmca_
    complexed with cl, d29, gtp, mg

Details for d5zpua_

PDB Entry: 5zpu (more details), 2.6 Å

PDB Description: lfs829 in complex with crm1-ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5zpua_:

Sequence, based on SEQRES records: (download)

>d5zpua_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampaaappev
vmdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d5zpua_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampaaappel
aaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5zpua_:

Click to download the PDB-style file with coordinates for d5zpua_.
(The format of our PDB-style files is described here.)

Timeline for d5zpua_: