SCOPe 2.08: Domain d5znqb_: 5znq B:

Lineage for d5znqb_ (5znq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries)

8. Domain d5znqb_: 5znq B: [367960]
   automated match to d4mb6a_
   complexed with ade, cl, na

Details for d5znqb_

PDB Entry: 5znq, 1.75 Å

PDB Description: crystal structure of aprt from y. pseudotuberculosis with bound adenine (p21 space group).

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5znqb_:

Sequence; same for both SEQRES and ATOM records:

>d5znqb_ c.61.1.0 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
asktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkv
vgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgd
kvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsf
dgh

Timeline for d5znqb_:

• d5znqb_ first appeared in SCOPe 2.07