Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
Protein automated matches [190404] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187282] (4 PDB entries) |
Domain d6of8d1: 6of8 D:345-474 [367943] Other proteins in same PDB: d6of8a2, d6of8b2, d6of8c2, d6of8d2, d6of8g2 automated match to d1hkxe_ complexed with gol, k; mutant |
PDB Entry: 6of8 (more details), 2.1 Å
SCOPe Domain Sequences for d6of8d1:
Sequence, based on SEQRES records: (download)
>d6of8d1 d.17.4.7 (D:345-474) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws rnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqh vhmhrsgaps
>d6of8d1 d.17.4.7 (D:345-474) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws skpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqhvh mhrsgaps
Timeline for d6of8d1: