SCOPe 2.07: Domain d6of8d1: 6of8 D:345-474

Lineage for d6of8d1 (6of8 D:345-474)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
   automatically mapped to Pfam PF13474
   automatically mapped to Pfam PF08332

6. Protein automated matches [190404] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187282] (4 PDB entries)

8. Domain d6of8d1: 6of8 D:345-474 [367943]
   Other proteins in same PDB: d6of8a2, d6of8b2, d6of8c2, d6of8d2, d6of8g2
   automated match to d1hkxe_
   complexed with gol, k; mutant

Details for d6of8d1

PDB Entry: 6of8, 2.1 Å

PDB Description: structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii-alpha hub domain

PDB Compounds: (D:) Calcium/calmodulin-dependent protein kinase type II subunit alpha

SCOPe Domain Sequences for d6of8d1:

Sequence, based on SEQRES records:

>d6of8d1 d.17.4.7 (D:345-474) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
rnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqh
vhmhrsgaps

Sequence, based on observed residues (ATOM records):

>d6of8d1 d.17.4.7 (D:345-474) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
skpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqhvh
mhrsgaps

Timeline for d6of8d1:

• d6of8d1 is new in SCOPe 2.07-stable
  
• d6of8d1 appears in the current release, SCOPe 2.08