Lineage for d6qjlb_ (6qjl B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. Species Human (Homo sapiens) [TaxId:9606] [74932] (10 PDB entries)
  8. Domain d6qjlb_: 6qjl B: [367938]
    automated match to d5w72a_
    complexed with gol, so4; mutant

Details for d6qjlb_

PDB Entry: 6qjl (more details), 1.04 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332g mutant: space group p21
PDB Compounds: (B:) Disks large homolog 4

SCOPe Domain Sequences for d6qjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qjlb_ b.36.1.1 (B:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfe

SCOPe Domain Coordinates for d6qjlb_ are not available.

Timeline for d6qjlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6qjla_