Lineage for d1l56__ (1l56 -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 596519Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 596525Protein Phage T4 lysozyme [53982] (1 species)
  7. 596526Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
    many mutant structures
  8. 596734Domain d1l56__: 1l56 - [36793]
    complexed with seo; mutant

Details for d1l56__

PDB Entry: 1l56 (more details), 1.8 Å

PDB Description: analysis of the interaction between charged side chains and the alpha- helix dipole using designed thermostable mutants of phage t4 lysozyme

SCOP Domain Sequences for d1l56__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l56__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitp
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d1l56__:

Click to download the PDB-style file with coordinates for d1l56__.
(The format of our PDB-style files is described here.)

Timeline for d1l56__: