Lineage for d6of8a1 (6of8 A:345-472)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543869Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 2543890Protein automated matches [190404] (2 species)
    not a true protein
  7. 2543891Species Human (Homo sapiens) [TaxId:9606] [187282] (4 PDB entries)
  8. 2543897Domain d6of8a1: 6of8 A:345-472 [367879]
    Other proteins in same PDB: d6of8a2, d6of8b2, d6of8c2, d6of8d2, d6of8g2
    automated match to d1hkxe_
    complexed with gol, k; mutant

Details for d6of8a1

PDB Entry: 6of8 (more details), 2.1 Å

PDB Description: structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii-alpha hub domain
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase type II subunit alpha

SCOPe Domain Sequences for d6of8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6of8a1 d.17.4.7 (A:345-472) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
rnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqh
vhmhrsga

SCOPe Domain Coordinates for d6of8a1:

Click to download the PDB-style file with coordinates for d6of8a1.
(The format of our PDB-style files is described here.)

Timeline for d6of8a1: