Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries) |
Domain d6ne5b_: 6ne5 B: [367863] automated match to d2kbwa_ complexed with kjp |
PDB Entry: 6ne5 (more details), 1.85 Å
SCOPe Domain Sequences for d6ne5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ne5b_ f.1.4.1 (B:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhve
Timeline for d6ne5b_: