SCOP 1.73: Domain d1l86a_: 1l86 A:

Lineage for d1l86a_ (1l86 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (431 PDB entries)
   many mutant structures

8. Domain d1l86a_: 1l86 A: [36786]
   complexed with cl, seo; mutant

Details for d1l86a_

PDB Entry: 1l86, 1.8 Å

PDB Description: similar hydrophobic replacements of leu 99 and phe 153 within the core of t4 lysozyme have different structural and thermodynamic consequences

PDB Compounds: (A:) t4 lysozyme

SCOP Domain Sequences for d1l86a_:

Sequence; same for both SEQRES and ATOM records:

>d1l86a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittirtgtwdayk

Timeline for d1l86a_:

• d1l86a_ first appeared (with stable ids) in SCOP 1.55, called d1l86__
  
• d1l86a_ was called d1l86__ in SCOP 1.71
  
• d1l86a_ appears in SCOP 1.75
  
• d1l86a_ appears in the current release, SCOPe 2.08