SCOP 1.69: Domain d1l86__: 1l86 -

Lineage for d1l86__ (1l86 -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (397 PDB entries)
   many mutant structures

8. Domain d1l86__: 1l86 - [36786]

Details for d1l86__

PDB Entry: 1l86, 1.8 Å

PDB Description: similar hydrophobic replacements of leu 99 and phe 153 within the core of t4 lysozyme have different structural and thermodynamic consequences

SCOP Domain Sequences for d1l86__:

Sequence; same for both SEQRES and ATOM records:

>d1l86__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittirtgtwdayk

Timeline for d1l86__:

• d1l86__ first appeared (with stable ids) in SCOP 1.55
  
• d1l86__ appears in SCOP 1.67
  
• d1l86__ appears in SCOP 1.71
  
• d1l86__ appears in the current release, SCOPe 2.08, called d1l86a_