Lineage for d6ms3b2 (6ms3 B:313-515)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 3067786Species Bacillus licheniformis [TaxId:279010] [367848] (2 PDB entries)
  8. 3067787Domain d6ms3b2: 6ms3 B:313-515 [367849]
    Other proteins in same PDB: d6ms3a1, d6ms3b1
    automated match to d5joza2
    complexed with ca, gol, imd, so4; mutant

Details for d6ms3b2

PDB Entry: 6ms3 (more details), 1.95 Å

PDB Description: crystal structure of the gh43 protein blxynb mutant (k247s) from bacillus licheniformis
PDB Compounds: (B:) Glycoside hydrolase family 43

SCOPe Domain Sequences for d6ms3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ms3b2 b.29.1.0 (B:313-515) automated matches {Bacillus licheniformis [TaxId: 279010]}
deknfddfdedtlgldwqfvrnpdhsswslierpgylrlwtgdwdlhdirakntvvrrek
hhlysagvkldfspsasgeqagivcyystnnylkccliyeeglkikvvenrsgcqktlgk
khaeagplflkavinkqkrdfyysyegkhwhhaggtedasflsdegsrdakghtgtmvgi
fannggsgrkaaadfdwfryiay

SCOPe Domain Coordinates for d6ms3b2:

Click to download the PDB-style file with coordinates for d6ms3b2.
(The format of our PDB-style files is described here.)

Timeline for d6ms3b2:

  • d6ms3b2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ms3b1