Lineage for d6ms3b1 (6ms3 B:5-312)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (7 species)
    not a true protein
  7. 3067784Species Bacillus licheniformis [TaxId:279010] [367846] (2 PDB entries)
  8. 3067785Domain d6ms3b1: 6ms3 B:5-312 [367847]
    Other proteins in same PDB: d6ms3a2, d6ms3b2
    automated match to d5joza1
    complexed with ca, gol, imd, so4; mutant

Details for d6ms3b1

PDB Entry: 6ms3 (more details), 1.95 Å

PDB Description: crystal structure of the gh43 protein blxynb mutant (k247s) from bacillus licheniformis
PDB Compounds: (B:) Glycoside hydrolase family 43

SCOPe Domain Sequences for d6ms3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ms3b1 b.67.2.0 (B:5-312) automated matches {Bacillus licheniformis [TaxId: 279010]}
htytnpvltgfhpdpsiirvgedyymvnstfqyfpaivishskdlvhwkiighgiteneg
ldlsdindshgiwapdisyhngtfyifathrlngptvingrklirrqimikssrpegpys
kpvfidegsgidpshfvdgdgkhymllspactlfplneectdisgepvqiwegtgrrape
gphllkkdgyyyailaeggtgyshsittarsthlygpyepcpynpiltqtdpdapiqrag
hgslvetqngewwavylcgrpnqgsyttvgretaldpvewtddgwfvinnlkgpslvqra
pnlpqvkw

SCOPe Domain Coordinates for d6ms3b1:

Click to download the PDB-style file with coordinates for d6ms3b1.
(The format of our PDB-style files is described here.)

Timeline for d6ms3b1:

  • d6ms3b1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ms3b2