SCOPe 2.08: Domain d6maxa1: 6max A:9-115

Lineage for d6maxa1 (6max A:9-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.2: RNase P protein [54220] (2 proteins)
   automatically mapped to Pfam PF00825

6. Protein automated matches [357987] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [366347] (2 PDB entries)

8. Domain d6maxa1: 6max A:9-115 [367844]
   Other proteins in same PDB: d6maxa2
   automated match to d1nz0c_
   protein/RNA complex; complexed with 9tf, so4

Details for d6maxa1

PDB Entry: 6max, 1.42 Å

PDB Description: crystal structure of ribonuclease p protein from thermotoga maritima in complex with purpurin

PDB Compounds: (A:) Ribonuclease P protein component

SCOPe Domain Sequences for d6maxa1:

Sequence; same for both SEQRES and ATOM records:

>d6maxa1 d.14.1.2 (A:9-115) automated matches {Thermotoga maritima [TaxId: 243274]}
erlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvr
eifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkri

Timeline for d6maxa1:

• d6maxa1 first appeared in SCOPe 2.07