Lineage for d6h6kc2 (6h6k C:207-320)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. 2402992Species Sulfolobus solfataricus [TaxId:273057] [256084] (13 PDB entries)
  8. 2403005Domain d6h6kc2: 6h6k C:207-320 [367830]
    Other proteins in same PDB: d6h6ka1, d6h6ka3, d6h6kb1, d6h6kb3, d6h6kc1, d6h6kc3, d6h6kd1, d6h6kd3, d6h6ke1, d6h6ke3
    automated match to d4m53a2
    complexed with edo, gcp, na; mutant

Details for d6h6kc2

PDB Entry: 6h6k (more details), 2 Å

PDB Description: the structure of the fkr mutant of the archaeal translation initiation factor 2 gamma subunit in complex with gdpcp, obtained in the absence of magnesium salts in the crystallization solution.
PDB Compounds: (C:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6h6kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6kc2 b.43.3.0 (C:207-320) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
rdlsqkpvmlvirsadvnapgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissiafgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d6h6kc2:

Click to download the PDB-style file with coordinates for d6h6kc2.
(The format of our PDB-style files is described here.)

Timeline for d6h6kc2: