SCOPe 2.07: Domain d6dfsb2: 6dfs B:114-242

Lineage for d6dfsb2 (6dfs B:114-242)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6dfsb2: 6dfs B:114-242 [367792]
   Other proteins in same PDB: d6dfsa2, d6dfsc1, d6dfsc2
   automated match to d2cdfb2
   complexed with nag

Details for d6dfsb2

PDB Entry: 6dfs, 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss

PDB Compounds: (B:) mouse TCR beta chain

SCOPe Domain Sequences for d6dfsb2:

Sequence; same for both SEQRES and ATOM records:

>d6dfsb2 b.1.1.0 (B:114-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6dfsb2:

• d6dfsb2 is new in SCOPe 2.07-stable
  
• d6dfsb2 appears in the current release, SCOPe 2.08