SCOPe 2.07: Domain d6dfsc2: 6dfs C:84-182

Lineage for d6dfsc2 (6dfs C:84-182)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6dfsc2: 6dfs C:84-182 [367790]
   Other proteins in same PDB: d6dfsa1, d6dfsb1, d6dfsb2, d6dfsc1
   automated match to d5ujta2
   complexed with nag

Details for d6dfsc2

PDB Entry: 6dfs, 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6dfsc2:

Sequence, based on SEQRES records:

>d6dfsc2 b.1.1.2 (C:84-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr
dhsfhklsyltfipsdddiydckvehwgleepvlkhwep

Sequence, based on observed residues (ATOM records):

>d6dfsc2 b.1.1.2 (C:84-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr
dhsfhklsyltfipsdddiydckvehwglepvlkhwep

Timeline for d6dfsc2:

• d6dfsc2 is new in SCOPe 2.07-stable
  
• d6dfsc2 appears in the current release, SCOPe 2.08