Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d6dfsc2: 6dfs C:84-182 [367790] Other proteins in same PDB: d6dfsa1, d6dfsa2, d6dfsb1, d6dfsb2, d6dfsc1 automated match to d5ujta2 complexed with nag |
PDB Entry: 6dfs (more details), 3.1 Å
SCOPe Domain Sequences for d6dfsc2:
Sequence, based on SEQRES records: (download)
>d6dfsc2 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr dhsfhklsyltfipsdddiydckvehwgleepvlkhwep
>d6dfsc2 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr dhsfhklsyltfipsdddiydckvehwglepvlkhwep
Timeline for d6dfsc2:
View in 3D Domains from other chains: (mouse over for more information) d6dfsa1, d6dfsa2, d6dfsb1, d6dfsb2 |