Lineage for d6dfsc2 (6dfs C:84-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747449Domain d6dfsc2: 6dfs C:84-182 [367790]
    Other proteins in same PDB: d6dfsa1, d6dfsa2, d6dfsb1, d6dfsb2, d6dfsc1
    automated match to d5ujta2
    complexed with nag

Details for d6dfsc2

PDB Entry: 6dfs (more details), 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6dfsc2:

Sequence, based on SEQRES records: (download)

>d6dfsc2 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr
dhsfhklsyltfipsdddiydckvehwgleepvlkhwep

Sequence, based on observed residues (ATOM records): (download)

>d6dfsc2 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnr
dhsfhklsyltfipsdddiydckvehwglepvlkhwep

SCOPe Domain Coordinates for d6dfsc2:

Click to download the PDB-style file with coordinates for d6dfsc2.
(The format of our PDB-style files is described here.)

Timeline for d6dfsc2: