Lineage for d6gexa_ (6gex A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. Species Trypanosoma brucei [TaxId:5702] [226783] (32 PDB entries)
  8. Domain d6gexa_: 6gex A: [367782]
    automated match to d3bmob_
    complexed with act, ewk, gol, nap

Details for d6gexa_

PDB Entry: 6gex (more details), 1.7800000000000002 Å

PDB Description: trypanosoma brucei ptr1 in complex with inhibitor 2h (f246)
PDB Compounds: (A:) pteridine reductase

SCOPe Domain Sequences for d6gexa_:

Sequence, based on SEQRES records: (download)

>d6gexa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d6gexa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiap
flltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
gglslvha

SCOPe Domain Coordinates for d6gexa_ are not available.

Timeline for d6gexa_:

Domains from other chains:
(mouse over for more information)
d6gexb_, d6gexc_, d6gexd_