SCOPe 2.08: Domain d6dfsa1: 6dfs A:1-117

Lineage for d6dfsa1 (6dfs A:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6dfsa1: 6dfs A:1-117 [367771]
   Other proteins in same PDB: d6dfsa2, d6dfsc1, d6dfsc2
   automated match to d2f54d1
   complexed with nag

Details for d6dfsa1

PDB Entry: 6dfs, 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss

PDB Compounds: (A:) mouse TCR alpha chain

SCOPe Domain Sequences for d6dfsa1:

Sequence; same for both SEQRES and ATOM records:

>d6dfsa1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpn

Timeline for d6dfsa1:

• d6dfsa1 first appeared in SCOPe 2.07