Lineage for d6d0va_ (6d0v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827224Protein Trp synthase alpha-subunit [51388] (9 species)
  7. 2827273Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries)
  8. 2827309Domain d6d0va_: 6d0v A: [367738]
    Other proteins in same PDB: d6d0vb1, d6d0vb2
    automated match to d1k8ya_
    complexed with 0jo, cl, cs, dms, edo, f9f, peg, ser; mutant

Details for d6d0va_

PDB Entry: 6d0v (more details), 1.64 Å

PDB Description: tryptophan synthase q114a mutant in complex with inhibitor n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the alpha-site, aminoacrylate at the beta site, and cesium ion at the metal coordination site
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d6d0va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d0va_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d6d0va_:

Click to download the PDB-style file with coordinates for d6d0va_.
(The format of our PDB-style files is described here.)

Timeline for d6d0va_: