SCOPe 2.08: Domain d6dfxj1: 6dfx J:3-111

Lineage for d6dfxj1 (6dfx J:3-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6dfxj1: 6dfx J:3-111 [367728]
   Other proteins in same PDB: d6dfxa1, d6dfxa2, d6dfxd1, d6dfxd2, d6dfxg2, d6dfxh2, d6dfxi2, d6dfxj2
   automated match to d2ak4e1
   complexed with edo, nag

Details for d6dfxj1

PDB Entry: 6dfx, 2.03 Å

PDB Description: human diabetogenic tcr t1d3 in complex with dq8-p8e9e peptide

PDB Compounds: (J:) T1D3 beta chain

SCOPe Domain Sequences for d6dfxj1:

Sequence; same for both SEQRES and ATOM records:

>d6dfxj1 b.1.1.0 (J:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
rfsgrqfsnsrsemnvstlelgdsalylcassagntiyfgegswltvve

Timeline for d6dfxj1:

• d6dfxj1 first appeared in SCOPe 2.07