Lineage for d6d0fb_ (6d0f B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Estrogen receptor alpha [48519] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. Domain d6d0fb_: 6d0f B: [367719]
    automated match to d3q95b_
    complexed with fys; mutant

Details for d6d0fb_

PDB Entry: 6d0f (more details), 2.5 Å

PDB Description: estrogen receptor alpha ligand binding domain y537s mutant in complex with 3ohtpe and grip peptide
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d6d0fb_:

Sequence, based on SEQRES records: (download)

>d6d0fb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemlda
h

Sequence, based on observed residues (ATOM records): (download)

>d6d0fb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdltl
hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvmveifdmllatssr
frmmnlqgeefvclksiillnsgvytfdhihrvldkitdtlihlmakagltlqqqhqrla
qlllilshirhmsnkgmehlysmkplsdlllemldah

SCOPe Domain Coordinates for d6d0fb_ are not available.

Timeline for d6d0fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6d0fa_