Lineage for d6d49a1 (6d49 A:18-142)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. Domain d6d49a1: 6d49 A:18-142 [367711]
    Other proteins in same PDB: d6d49a2, d6d49b2
    automated match to d1nkoa_
    complexed with fvp, gol

Details for d6d49a1

PDB Entry: 6d49 (more details), 1.8 Å

PDB Description: cell surface receptor in complex with ligand at 1.80-a resolution
PDB Compounds: (A:) Myeloid cell surface antigen CD33

SCOPe Domain Sequences for d6d49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d49a1 b.1.1.1 (A:18-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
vtdlt

SCOPe Domain Coordinates for d6d49a1 are not available.

Timeline for d6d49a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6d49a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d49b1, d6d49b2