Lineage for d6r8xa_ (6r8x A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (48 PDB entries)
    Uniprot P03951 388-624
  8. 3067611Domain d6r8xa_: 6r8x A: [367673]
    automated match to d3bg8a_

Details for d6r8xa_

PDB Entry: 6r8x (more details), 2.04 Å

PDB Description: coagulation factor xi catalytic domain in complex with fab-portion of maa868
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d6r8xa_:

Sequence, based on SEQRES records: (download)

>d6r8xa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
tasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysgilnq
seikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdrnviy
tdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggkdac
kgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

Sequence, based on observed residues (ATOM records): (download)

>d6r8xa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
tasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysgilnq
seikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdrnviy
tdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreackgds
ggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

SCOPe Domain Coordinates for d6r8xa_:

Click to download the PDB-style file with coordinates for d6r8xa_.
(The format of our PDB-style files is described here.)

Timeline for d6r8xa_:

  • d6r8xa_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-11