Lineage for d5zigd_ (5zig D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335407Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2335408Protein automated matches [190108] (21 species)
    not a true protein
  7. 2335468Species Spirochaeta thermophila [TaxId:665571] [367658] (1 PDB entry)
  8. 2335472Domain d5zigd_: 5zig D: [367659]
    automated match to d3wkfa_
    complexed with edo

Details for d5zigd_

PDB Entry: 5zig (more details), 2.05 Å

PDB Description: the structure of cellobiose 2-epimerase from spirochaeta thermophila dsm 6192
PDB Compounds: (D:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d5zigd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zigd_ a.102.1.0 (D:) automated matches {Spirochaeta thermophila [TaxId: 665571]}
ttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmtarhl
wtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkklygnaf
avyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpeplgege
tpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfaedwap
mgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslpneqr
edgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggewfwav
tpegsplagyekggmwkasyhnsraclegmrridtile

SCOPe Domain Coordinates for d5zigd_:

Click to download the PDB-style file with coordinates for d5zigd_.
(The format of our PDB-style files is described here.)

Timeline for d5zigd_: