Lineage for d6g40c2 (6g40 C:136-324)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. Protein 8-oxoguanine glycosylase [48160] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [419766] (3 PDB entries)
  8. Domain d6g40c2: 6g40 C:136-324 [367613]
    Other proteins in same PDB: d6g40a1, d6g40b1, d6g40c1, d6g40c3
    automated match to d2xhia2
    protein/DNA complex; complexed with act, elk, ni, peg

Details for d6g40c2

PDB Entry: 6g40 (more details), 2.4899999999999998 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th9525
PDB Compounds: (C:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g40c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g40c2 a.96.1.3 (C:136-324) 8-oxoguanine glycosylase {Mouse (Mus musculus) [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq
avlfsadlr

SCOPe Domain Coordinates for d6g40c2 are not available.

Timeline for d6g40c2:

Domains from same chain:
(mouse over for more information)
d6g40c1, d6g40c3
Domains from other chains:
(mouse over for more information)
d6g40a1, d6g40a2, d6g40b1, d6g40b2