Lineage for d6o44a1 (6o44 A:1-275)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453146Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2453147Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2453148Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2453349Protein automated matches [190073] (15 species)
    not a true protein
  7. 2453403Species Bacillus subtilis [TaxId:1423] [187756] (2 PDB entries)
  8. 3067533Domain d6o44a1: 6o44 A:1-275 [367595]
    Other proteins in same PDB: d6o44a2, d6o44b2
    automated match to d1scja_
    complexed with ca, edo, so4

Details for d6o44a1

PDB Entry: 6o44 (more details), 1.83 Å

PDB Description: insight into subtilisin e-s7 cleavage pattern based on crystal structure and hydrolysates peptide analysis
PDB Compounds: (A:) Nattokinase

SCOPe Domain Sequences for d6o44a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o44a1 c.41.1.1 (A:1-275) automated matches {Bacillus subtilis [TaxId: 1423]}
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
wtnaqvrdrlestatylgnsfyygkglinvqaaaq

SCOPe Domain Coordinates for d6o44a1:

Click to download the PDB-style file with coordinates for d6o44a1.
(The format of our PDB-style files is described here.)

Timeline for d6o44a1:

  • d6o44a1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6o44a2