SCOP 1.69: Domain d6lzm__: 6lzm -

Lineage for d6lzm__ (6lzm -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (397 PDB entries)
   many mutant structures

8. Domain d6lzm__: 6lzm - [36758]

Details for d6lzm__

PDB Entry: 6lzm, 1.8 Å

PDB Description: comparison of the crystal structure of bacteriophage t4 lysozyme at low, medium, and high ionic strengths

SCOP Domain Sequences for d6lzm__:

Sequence; same for both SEQRES and ATOM records:

>d6lzm__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d6lzm__:

• d6lzm__ first appeared (with stable ids) in SCOP 1.55
  
• d6lzm__ appears in SCOP 1.67
  
• d6lzm__ appears in SCOP 1.71
  
• d6lzm__ appears in the current release, SCOPe 2.08, called d6lzma_