Lineage for d6n96a_ (6n96 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853193Protein Methylmalonyl CoA decarboxylase [52110] (2 species)
  7. 2853199Species Escherichia coli [TaxId:83333] [367511] (6 PDB entries)
  8. 2853200Domain d6n96a_: 6n96 A: [367556]
    automated match to d1ef8a_
    complexed with imd, lcv, so5

Details for d6n96a_

PDB Entry: 6n96 (more details), 1.7 Å

PDB Description: methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- oxa(dethia)-coa
PDB Compounds: (A:) Methylmalonyl-CoA decarboxylase

SCOPe Domain Sequences for d6n96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n96a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 83333]}
ayqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskv
fsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdli
iaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhv
veveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydse
dyqegmnaflekrkpnfvgh

SCOPe Domain Coordinates for d6n96a_:

Click to download the PDB-style file with coordinates for d6n96a_.
(The format of our PDB-style files is described here.)

Timeline for d6n96a_: