![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Acipenser persicus [TaxId:61968] [333390] (1 PDB entry) |
![]() | Domain d6iyha_: 6iyh A: [367543] Other proteins in same PDB: d6iyhb_ automated match to d5jgga_ complexed with hem, pgo |
PDB Entry: 6iyh (more details), 1.7 Å
SCOPe Domain Sequences for d6iyha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iyha_ a.1.1.2 (A:) automated matches {Acipenser persicus [TaxId: 61968]} sltsadkshvksiwskasgkaeelgaealgrmlevfpntktyfshyadlsvssgqvhthg kkildaittavnhidditgtmtalstlhaktlrvdpanfkilshtilvvlalyfpadftp evhlacdkflasvshtlatkyr
Timeline for d6iyha_: