SCOPe 2.08: Domain d6iyha_: 6iyh A:

Lineage for d6iyha_ (6iyh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Acipenser persicus [TaxId:61968] [333390] (1 PDB entry)

8. Domain d6iyha_: 6iyh A: [367543]
   Other proteins in same PDB: d6iyhb_
   automated match to d5jgga_
   complexed with hem, pgo

Details for d6iyha_

PDB Entry: 6iyh, 1.7 Å

PDB Description: x-ray sequence and high resolution crystal structure of persian sturgeon methemoglobin

PDB Compounds: (A:) Alpha chain

SCOPe Domain Sequences for d6iyha_:

Sequence; same for both SEQRES and ATOM records:

>d6iyha_ a.1.1.2 (A:) automated matches {Acipenser persicus [TaxId: 61968]}
sltsadkshvksiwskasgkaeelgaealgrmlevfpntktyfshyadlsvssgqvhthg
kkildaittavnhidditgtmtalstlhaktlrvdpanfkilshtilvvlalyfpadftp
evhlacdkflasvshtlatkyr

Timeline for d6iyha_:

• d6iyha_ first appeared in SCOPe 2.07