SCOPe 2.07: Domain d6iyib_: 6iyi B:

Lineage for d6iyib_ (6iyi B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Acipenser stellatus [TaxId:7903] [333724] (2 PDB entries)

8. Domain d6iyib_: 6iyi B: [367538]
   automated match to d5jnzb_
   complexed with gol, hem

Details for d6iyib_

PDB Entry: 6iyi, 2.2 Å

PDB Description: x-ray sequence and high resolution crystal structure of starry sturgeon methemoglobin

PDB Compounds: (B:) Beta chain

SCOPe Domain Sequences for d6iyib_:

Sequence; same for both SEQRES and ATOM records:

>d6iyib_ a.1.1.0 (B:) automated matches {Acipenser stellatus [TaxId: 7903]}
vkwtdserfaittlwakvdvervgaqalvrllvvypwtqryfgafgnisdaaaiagnakv
hahgktvlssvgiaiahmddlagaftalsafhsetlhvdpdnfehfgdclsivlaatfgt
aytpdvhaawqkmiaviisalskeyh

Timeline for d6iyib_:

• d6iyib_ is new in SCOPe 2.07-stable
  
• d6iyib_ appears in the current release, SCOPe 2.08