![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
![]() | Protein automated matches [227004] (3 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [353655] (2 PDB entries) |
![]() | Domain d6g2ub1: 6g2u B:11-212 [367531] Other proteins in same PDB: d6g2ua2, d6g2ub2, d6g2uc2, d6g2ud2, d6g2ue2, d6g2uf2 automated match to d3etda1 complexed with cl, na, po4 |
PDB Entry: 6g2u (more details), 2.93 Å
SCOPe Domain Sequences for d6g2ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g2ub1 c.58.1.1 (B:11-212) automated matches {Homo sapiens [TaxId: 9606]} pnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsfpir rddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfggak agvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadtyast ighydinahacvtgkpisqggi
Timeline for d6g2ub1: