Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Pseudomonas sp [TaxId:306] [367386] (5 PDB entries) |
Domain d6g4db1: 6g4d B:6-455 [367523] Other proteins in same PDB: d6g4da2, d6g4db2 automated match to d4ah3a_ complexed with gol, plp |
PDB Entry: 6g4d (more details), 2.15 Å
SCOPe Domain Sequences for d6g4db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g4db1 c.67.1.0 (B:6-455) automated matches {Pseudomonas sp [TaxId: 306]} sslpekdiqyqlhpytnarlhqelgpliiergegiyvyddqgkgyieamaglwsaalgfs nqrlikaaeqqfntlpfyhlfshkshrpsielaekliemapvpmskvfftnsgseandtv vkmvwylnnalgkpakkkfisrvngyhgitvasasltglpgnqrgfdlplpgflhvgcph hyrfalageseehfadrlaveleqkilaegpetiaafigeplmgaggvivpprtywekiq kvcrkydilviadevicgfgrtgqmfgsqtfgiqpdimvlskqlsssyqpiaailinapv fegiadqsqalgalghgftgsghpvatavalenlkiieeeslvehaaqmgqllrsglqhf idhplvgeirgcgliaavelvgdrvskapyqalgtlgrymagraqehgmitramgdavaf cpplivneqevgmiverfaralddttqwvg
Timeline for d6g4db1: