Lineage for d6jmic_ (6jmi C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694938Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries)
  8. 2694945Domain d6jmic_: 6jmi C: [367495]
    automated match to d4ggga_
    complexed with so4

Details for d6jmic_

PDB Entry: 6jmi (more details), 2.9 Å

PDB Description: crystal structure of m.tuberculosis rv0081
PDB Compounds: (C:) Uncharacterized HTH-type transcriptional regulator Rv0081

SCOPe Domain Sequences for d6jmic_:

Sequence, based on SEQRES records: (download)

>d6jmic_ a.4.5.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
seplyklkaeffktlahparirilellverdrsvgellssdvglessnlsqqlgvlrrag
vvaarrdgnamiysiaapdiaellavarkvlarvlsdrva

Sequence, based on observed residues (ATOM records): (download)

>d6jmic_ a.4.5.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
seplyklkaeffktlahparirilellverdrsvgellssdvsnlsqqlgvlrragvvaa
rrdgnamiysiaapdiaellavarkvlarvlsdrva

SCOPe Domain Coordinates for d6jmic_:

Click to download the PDB-style file with coordinates for d6jmic_.
(The format of our PDB-style files is described here.)

Timeline for d6jmic_: