![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries) |
![]() | Domain d6jmia_: 6jmi A: [367492] automated match to d4ggga_ complexed with so4 |
PDB Entry: 6jmi (more details), 2.9 Å
SCOPe Domain Sequences for d6jmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jmia_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} seplyklkaeffktlahparirilellverdrsvgellssdvglessnlsqqlgvlrrag vvaarrdgnamiysiaapdiaellavarkvlarvlsdrva
Timeline for d6jmia_: