Lineage for d6ihcg_ (6ihc G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706278Species Helicobacter pylori [TaxId:210] [324772] (3 PDB entries)
  8. 2706279Domain d6ihcg_: 6ihc G: [367488]
    Other proteins in same PDB: d6ihca_, d6ihcb_, d6ihcc_, d6ihcd_, d6ihce_, d6ihcf_
    automated match to d5h9hb_
    complexed with cit, pn7; mutant

Details for d6ihcg_

PDB Entry: 6ihc (more details), 2.4 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) y100a mutant in complex with holo-acp from helicobacter pylori
PDB Compounds: (G:) holo-form acyl carrier protein (holo-ACP)

SCOPe Domain Sequences for d6ihcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ihcg_ a.28.1.0 (G:) automated matches {Helicobacter pylori [TaxId: 210]}
iqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqaekivnvg
dvvky

SCOPe Domain Coordinates for d6ihcg_:

Click to download the PDB-style file with coordinates for d6ihcg_.
(The format of our PDB-style files is described here.)

Timeline for d6ihcg_: