![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (29 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [324772] (3 PDB entries) |
![]() | Domain d6ihcg_: 6ihc G: [367488] Other proteins in same PDB: d6ihca_, d6ihcb_, d6ihcc_, d6ihcd_, d6ihce_, d6ihcf_ automated match to d5h9hb_ complexed with cit, pn7; mutant |
PDB Entry: 6ihc (more details), 2.4 Å
SCOPe Domain Sequences for d6ihcg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ihcg_ a.28.1.0 (G:) automated matches {Helicobacter pylori [TaxId: 210]} iqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqaekivnvg dvvky
Timeline for d6ihcg_: