Lineage for d6iyia_ (6iyi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302854Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302855Protein automated matches [190590] (26 species)
    not a true protein
  7. 2302859Species Acipenser stellatus [TaxId:7903] [333724] (2 PDB entries)
  8. 2302860Domain d6iyia_: 6iyi A: [367478]
    automated match to d5jnza_
    complexed with gol, hem

Details for d6iyia_

PDB Entry: 6iyi (more details), 2.2 Å

PDB Description: x-ray sequence and high resolution crystal structure of starry sturgeon methemoglobin
PDB Compounds: (A:) Alpha chain

SCOPe Domain Sequences for d6iyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iyia_ a.1.1.0 (A:) automated matches {Acipenser stellatus [TaxId: 7903]}
sltsadkshvrsiwskaggsaeeigaealgrmlesfpntktyfdhyadlsvssaqvhthg
kkiidalttavnhidditgalsslstlhaqtlrvdpanfkilshtilvvlalyfpadftp
evhlacdkflanvshaladnyr

SCOPe Domain Coordinates for d6iyia_:

Click to download the PDB-style file with coordinates for d6iyia_.
(The format of our PDB-style files is described here.)

Timeline for d6iyia_: