| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Acipenser stellatus [TaxId:7903] [333724] (2 PDB entries) |
| Domain d6iyia_: 6iyi A: [367478] automated match to d5jnza_ complexed with gol, hem |
PDB Entry: 6iyi (more details), 2.2 Å
SCOPe Domain Sequences for d6iyia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iyia_ a.1.1.0 (A:) automated matches {Acipenser stellatus [TaxId: 7903]}
sltsadkshvrsiwskaggsaeeigaealgrmlesfpntktyfdhyadlsvssaqvhthg
kkiidalttavnhidditgalsslstlhaqtlrvdpanfkilshtilvvlalyfpadftp
evhlacdkflanvshaladnyr
Timeline for d6iyia_: